PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000168550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 386aa    MW: 43776.5 Da    PI: 7.5855
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000168550genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
    MDP0000168550 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding45.41.8e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    MDP0000168550  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.316965IPR017930Myb domain
SuperFamilySSF466891.8E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002497.2E-161461IPR001005SANT/Myb domain
CDDcd001671.00E-101661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465117IPR009057Homeodomain-like
SMARTSM007173.5E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.7566116IPR017930Myb domain
PfamPF002497.1E-1367112IPR001005SANT/Myb domain
CDDcd001671.12E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MVRPPCCEKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDIKNYWNT HLKKKLKNFQ  120
SALDPHTTSD DLFNVNVSRR SLSEGSLDNM XSHASSIILR NNQSSSTYAS STENISRLLE  180
GWMRSSPTPK TSSLKHHAAC DNDQGKPSGI STGNLASNEE FESILSYENL NNVASWDRST  240
CDSSTYSNNK VSQLSIKVXN NGEIIHDRHL LRDEDQKSKQ ILRCESSSTN CNNPPLTFLE  300
KWLLDESAGH VEDDQMMELS PMSLVGTLTV IQVYRINHIL EQKWKQLSKN RGQWDLRDES  360
LVHAKEPSNP TYESKRIGQG DVRDET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391728.10.0PREDICTED: myb-related protein 306-like
SwissprotP813922e-87MYB06_ANTMA; Myb-related protein 306
TrEMBLM5VUV41e-175M5VUV4_PRUPE; Uncharacterized protein
STRINGPOPTR_0013s06390.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82033145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-99myb domain protein 60